PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc002146.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 294aa    MW: 33351.9 Da    PI: 6.3698
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc002146.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.11.4e-5271311128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeelv++yL++k+++ ++++  +i+e+d+yk++PwdLp ++  +ekewyfFs+rd+ky++g+r+nra+ +gyWkat
  Itr_sc002146.1_g00002.1   7 LPPGFRFHPTDEELVMHYLCRKCASLPISV-PIIAEIDLYKFDPWDLPDMALYGEKEWYFFSPRDRKYPNGSRPNRAAGRGYWKAT 91 
                              79****************************.88***************6666689******************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g dk++ +   + vg+kk Lvfy+g+apkgekt+W+mheyrl
  Itr_sc002146.1_g00002.1  92 GADKPIGQ--PKPVGIKKALVFYSGKAPKGEKTNWIMHEYRL 131
                              ******98..789***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-623158IPR003441NAC domain
PROSITE profilePS5100560.5577158IPR003441NAC domain
PfamPF023652.5E-278131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MAGGLQLPPG FRFHPTDEEL VMHYLCRKCA SLPISVPIIA EIDLYKFDPW DLPDMALYGE  60
KEWYFFSPRD RKYPNGSRPN RAAGRGYWKA TGADKPIGQP KPVGIKKALV FYSGKAPKGE  120
KTNWIMHEYR LADVDRSARK KSNSLRLDDW VLCRIYNKKG ELEKADGSIR NMSKATASSP  180
VSEEEEKKPE MMLPPPPQPQ PPQVFSDFLY LEPSDSIPKL HTESSCSEHV LSPEFTCDRE  240
VQSEAKMSEW DKTALNFPFN YQNATADGGF LGCGDLPGSY DAWPLQDMLL YKPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-81516413174Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAPTransfer from AT1G01720Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009629774.11e-153PREDICTED: NAC domain-containing protein 2
RefseqXP_016481807.11e-153PREDICTED: NAC domain-containing protein 2-like
SwissprotQ390131e-137NAC2_ARATH; NAC domain-containing protein 2
TrEMBLQ8LRL51e-154Q8LRL5_PETHY; Nam-like protein 10
STRINGSolyc06g060230.2.11e-147(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12392481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-130NAC family protein